ZFPM1 polyclonal antibody (A01)
  • ZFPM1 polyclonal antibody (A01)

ZFPM1 polyclonal antibody (A01)

Ref: AB-H00161882-A01
ZFPM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZFPM1.
Información adicional
Size 50 uL
Gene Name ZFPM1
Gene Alias FOG|FOG1|ZNF408|ZNF89A
Gene Description zinc finger protein, multitype 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPSPALTLLLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPVPAGGLLSVLLTAEPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZFPM1 (NP_722520, 86 a.a. ~ 195 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 161882

Enviar un mensaje


ZFPM1 polyclonal antibody (A01)

ZFPM1 polyclonal antibody (A01)