Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZFPM1 polyclonal antibody (A01)
Abnova
ZFPM1 polyclonal antibody (A01)
Ref: AB-H00161882-A01
ZFPM1 polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant ZFPM1.
Información adicional
Size
50 uL
Gene Name
ZFPM1
Gene Alias
FOG|FOG1|ZNF408|ZNF89A
Gene Description
zinc finger protein, multitype 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
WSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPSPALTLLLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPVPAGGLLSVLLTAEPH
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZFPM1 (NP_722520, 86 a.a. ~ 195 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
161882
Enviar un mensaje
ZFPM1 polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*