TTC16 MaxPab mouse polyclonal antibody (B01P)
  • TTC16 MaxPab mouse polyclonal antibody (B01P)

TTC16 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00158248-B01P
TTC16 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TTC16 protein.
Información adicional
Size 50 ug
Gene Name TTC16
Gene Alias FLJ32780
Gene Description tetratricopeptide repeat domain 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTDSDEDALKVDQGPSRDIPKPWVIPAPKGILQHIFGTSHVFQSICDVKPKVTGLTVPLKVREYYSRGQQCLEQADWETAVLLFSRALHLDPQLVDFYALRAEAYLQLCDFSSAAQNLRRAYSLQQDNCKHLERLTFVLYLQGQCLFEQCAFLDALNVFSHAAELQPEKPCFRYRCMACLLALKQHQACLTLITNELKQDTTNADVYIFRARLYNFLQKPHLCYRDLHSALLLNPKHPQARMLLQKMVAQAQQAR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC16 (AAH31281, 1 a.a. ~ 873 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 158248

Enviar un mensaje


TTC16 MaxPab mouse polyclonal antibody (B01P)

TTC16 MaxPab mouse polyclonal antibody (B01P)