C9orf98 monoclonal antibody (M01), clone 3B8
  • C9orf98 monoclonal antibody (M01), clone 3B8

C9orf98 monoclonal antibody (M01), clone 3B8

Ref: AB-H00158067-M01
C9orf98 monoclonal antibody (M01), clone 3B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C9orf98.
Información adicional
Size 100 ug
Gene Name C9orf98
Gene Alias DDX31|FLJ32704|FLJ36014|RP11-143F18.1
Gene Description chromosome 9 open reading frame 98
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq PFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C9orf98 (NP_689785, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 158067
Clone Number 3B8
Iso type IgG1 Kappa

Enviar un mensaje


C9orf98 monoclonal antibody (M01), clone 3B8

C9orf98 monoclonal antibody (M01), clone 3B8