AGR3 purified MaxPab rabbit polyclonal antibody (D01P)
  • AGR3 purified MaxPab rabbit polyclonal antibody (D01P)

AGR3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00155465-D01P
AGR3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AGR3 protein.
Información adicional
Size 100 ug
Gene Name AGR3
Gene Alias AG3|BCMP11|HAG3|hAG-3
Gene Description anterior gradient homolog 3 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AGR3 (NP_789783.1, 1 a.a. ~ 166 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 155465

Enviar un mensaje


AGR3 purified MaxPab rabbit polyclonal antibody (D01P)

AGR3 purified MaxPab rabbit polyclonal antibody (D01P)