WBSCR27 monoclonal antibody (M02), clone 2A12
  • WBSCR27 monoclonal antibody (M02), clone 2A12

WBSCR27 monoclonal antibody (M02), clone 2A12

Ref: AB-H00155368-M02
WBSCR27 monoclonal antibody (M02), clone 2A12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant WBSCR27.
Información adicional
Size 100 ug
Gene Name WBSCR27
Gene Alias MGC40131
Gene Description Williams Beuren syndrome chromosome region 27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WBSCR27 (AAH30295.1, 1 a.a. ~ 245 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 155368
Clone Number 2A12
Iso type IgG1 Kappa

Enviar un mensaje


WBSCR27 monoclonal antibody (M02), clone 2A12

WBSCR27 monoclonal antibody (M02), clone 2A12