ARL6IP6 purified MaxPab mouse polyclonal antibody (B02P)
  • ARL6IP6 purified MaxPab mouse polyclonal antibody (B02P)

ARL6IP6 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00151188-B02P
ARL6IP6 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARL6IP6 protein.
Información adicional
Size 50 ug
Gene Name ARL6IP6
Gene Alias MGC33864|PFAAP1
Gene Description ADP-ribosylation-like factor 6 interacting protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARL6IP6 (NP_689735.1, 1 a.a. ~ 226 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 151188

Enviar un mensaje


ARL6IP6 purified MaxPab mouse polyclonal antibody (B02P)

ARL6IP6 purified MaxPab mouse polyclonal antibody (B02P)