ZSWIM2 purified MaxPab mouse polyclonal antibody (B01P)
  • ZSWIM2 purified MaxPab mouse polyclonal antibody (B01P)

ZSWIM2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00151112-B01P
ZSWIM2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZSWIM2 protein.
Información adicional
Size 50 ug
Gene Name ZSWIM2
Gene Alias MGC33890|ZZZ2
Gene Description zinc finger, SWIM-type containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFELPRNHESALQLGLGEREISDLLRGIHRVQTPQPGTNDENEHVEEDGYIKQKEIDSEDICSICQELLLEKKLPVTFCRFGCGNSIHIKCMKILANYQSTSNTSMLKCPLCRKEFAPLKLILEEFKNSSKLVAAAEKERLDKHLGIPCNNCKQFPIEGKCYKCTECIEY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZSWIM2 (AAH31094.1, 1 a.a. ~ 633 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 151112

Enviar un mensaje


ZSWIM2 purified MaxPab mouse polyclonal antibody (B01P)

ZSWIM2 purified MaxPab mouse polyclonal antibody (B01P)