UBE2U monoclonal antibody (M07), clone 3D4
  • UBE2U monoclonal antibody (M07), clone 3D4

UBE2U monoclonal antibody (M07), clone 3D4

Ref: AB-H00148581-M07
UBE2U monoclonal antibody (M07), clone 3D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE2U.
Información adicional
Size 100 ug
Gene Name UBE2U
Gene Alias MGC35130|RP4-636O23.1
Gene Description ubiquitin-conjugating enzyme E2U (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2U (NP_689702.1, 9 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 148581
Clone Number 3D4
Iso type IgG2a Kappa

Enviar un mensaje


UBE2U monoclonal antibody (M07), clone 3D4

UBE2U monoclonal antibody (M07), clone 3D4