Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZNRF4 monoclonal antibody (M01), clone 1A8
Abnova
ZNRF4 monoclonal antibody (M01), clone 1A8
Ref: AB-H00148066-M01
ZNRF4 monoclonal antibody (M01), clone 1A8
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZNRF4.
Información adicional
Size
100 ug
Gene Name
ZNRF4
Gene Alias
RNF204|SPERIZIN|Ssrzf1|spzn
Gene Description
zinc and ring finger 4
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
SSSVDFADLPALFGVPLAPEGIRGYLMEVKPANACHPIEAPRLGNRSLGSIALIRRYDCTFDL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZNRF4 (NP_859061.2, 108 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
148066
Clone Number
1A8
Iso type
IgG1 Kappa
Enviar un mensaje
ZNRF4 monoclonal antibody (M01), clone 1A8
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*