ZNRF4 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNRF4 purified MaxPab mouse polyclonal antibody (B01P)

ZNRF4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00148066-B01P
ZNRF4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNRF4 protein.
Información adicional
Size 50 ug
Gene Name ZNRF4
Gene Alias RNF204|SPERIZIN|Ssrzf1|spzn
Gene Description zinc and ring finger 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPLCRPEHLMPRASRVPVAASLPLSHAVIPTQLPSRSGHRPPGRPRRCPKASCLPPPVGPSSTQTAKRVTMGWPRPGQALVAVKALLVLSLLQVPAQAVVRAVLEDNSSSVDFADLPALFGVPLAPEGIRGYLMEVKPANACHPIEAPRLGNRSLGSIALIRHYDCTFDLKVLNAQRAGFEAAIVHNVHSDDLVSMTHVYEDLRGQIAIPSVFVSEAASQDLRVILGCNKSAHALLLPDDPPCHDLGCHPVLTVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNRF4 (NP_859061.2, 1 a.a. ~ 429 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 148066

Enviar un mensaje


ZNRF4 purified MaxPab mouse polyclonal antibody (B01P)

ZNRF4 purified MaxPab mouse polyclonal antibody (B01P)