ANKRD29 MaxPab mouse polyclonal antibody (B01P)
  • ANKRD29 MaxPab mouse polyclonal antibody (B01P)

ANKRD29 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00147463-B01P
ANKRD29 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANKRD29 protein.
Información adicional
Size 50 ug
Gene Name ANKRD29
Gene Alias FLJ25053
Gene Description ankyrin repeat domain 29
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCRMSFKKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHIDCVRELVLQGADINLQRESGTTALFFAAQQGHNDVVRFLFGFGASTEFRTKDEGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRQDGTAPLWIASQMGHSEVVRVMLLRGADRDAARNDGTTALLKAANKGYNDVIKELLKFSPTLGILKNGTSALHAAVLSGN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANKRD29 (AAH30622.1, 1 a.a. ~ 301 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 147463

Enviar un mensaje


ANKRD29 MaxPab mouse polyclonal antibody (B01P)

ANKRD29 MaxPab mouse polyclonal antibody (B01P)