CCBE1 MaxPab rabbit polyclonal antibody (D01)
  • CCBE1 MaxPab rabbit polyclonal antibody (D01)

CCBE1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00147372-D01
CCBE1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCBE1 protein.
Información adicional
Size 100 uL
Gene Name CCBE1
Gene Alias FLJ30681|MGC50861
Gene Description collagen and calcium binding EGF domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCBE1 (AAH46645.1, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 147372

Enviar un mensaje


CCBE1 MaxPab rabbit polyclonal antibody (D01)

CCBE1 MaxPab rabbit polyclonal antibody (D01)