C18orf23 monoclonal antibody (M01), clone 3A1
  • C18orf23 monoclonal antibody (M01), clone 3A1

C18orf23 monoclonal antibody (M01), clone 3A1

Ref: AB-H00147341-M01
C18orf23 monoclonal antibody (M01), clone 3A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C18orf23.
Información adicional
Size 100 ug
Gene Name C18orf23
Gene Alias FLJ34218
Gene Description chromosome 18 open reading frame 23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA,IF
Immunogen Prot. Seq VSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQMVVHEIRNYPYPQLHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C18orf23 (NP_689683, 122 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 147341
Clone Number 3A1
Iso type IgG2a Kappa

Enviar un mensaje


C18orf23 monoclonal antibody (M01), clone 3A1

C18orf23 monoclonal antibody (M01), clone 3A1