C17orf38 polyclonal antibody (A01)
  • C17orf38 polyclonal antibody (A01)

C17orf38 polyclonal antibody (A01)

Ref: AB-H00146850-A01
C17orf38 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C17orf38.
Información adicional
Size 50 uL
Gene Name PIK3R6
Gene Alias C17orf38|DKFZp666P158|FLJ34500|HsT41028|p84|p87(PIKAP)|p87PIKAP
Gene Description phosphoinositide-3-kinase, regulatory subunit 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C17orf38 (NP_001010855, 661 a.a. ~ 754 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 146850

Enviar un mensaje


C17orf38 polyclonal antibody (A01)

C17orf38 polyclonal antibody (A01)