TMED6 purified MaxPab mouse polyclonal antibody (B01P)
  • TMED6 purified MaxPab mouse polyclonal antibody (B01P)

TMED6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00146456-B01P
TMED6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMED6 protein.
Información adicional
Size 50 ug
Gene Name TMED6
Gene Alias MGC23911|PRO34237|SPLL9146
Gene Description transmembrane emp24 protein transport domain containing 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMED6 (NP_653277.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 146456

Enviar un mensaje


TMED6 purified MaxPab mouse polyclonal antibody (B01P)

TMED6 purified MaxPab mouse polyclonal antibody (B01P)