C5orf20 purified MaxPab mouse polyclonal antibody (B01P)
  • C5orf20 purified MaxPab mouse polyclonal antibody (B01P)

C5orf20 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00140947-B01P
C5orf20 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C5orf20 protein.
Información adicional
Size 50 ug
Gene Name C5orf20
Gene Alias DCNP1
Gene Description chromosome 5 open reading frame 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPLQGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKTGQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C5orf20 (NP_570900.1, 1 a.a. ~ 244 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 140947

Enviar un mensaje


C5orf20 purified MaxPab mouse polyclonal antibody (B01P)

C5orf20 purified MaxPab mouse polyclonal antibody (B01P)