C20orf79 monoclonal antibody (M01), clone 3C11
  • C20orf79 monoclonal antibody (M01), clone 3C11

C20orf79 monoclonal antibody (M01), clone 3C11

Ref: AB-H00140856-M01
C20orf79 monoclonal antibody (M01), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant C20orf79.
Información adicional
Size 100 ug
Gene Name C20orf79
Gene Alias HSD22|MGC138229|dJ1068E13.2
Gene Description chromosome 20 open reading frame 79
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C20orf79 (NP_848578.1, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 140856
Clone Number 3C11
Iso type IgG2a Kappa

Enviar un mensaje


C20orf79 monoclonal antibody (M01), clone 3C11

C20orf79 monoclonal antibody (M01), clone 3C11