NANP purified MaxPab mouse polyclonal antibody (B01P)
  • NANP purified MaxPab mouse polyclonal antibody (B01P)

NANP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00140838-B01P
NANP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NANP protein.
Información adicional
Size 50 ug
Gene Name NANP
Gene Alias C20orf147|HDHD4|MGC26833|dJ694B14.3
Gene Description N-acetylneuraminic acid phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NANP (NP_689880.1, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 140838

Enviar un mensaje


NANP purified MaxPab mouse polyclonal antibody (B01P)

NANP purified MaxPab mouse polyclonal antibody (B01P)