TRIM69 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM69 purified MaxPab mouse polyclonal antibody (B01P)

TRIM69 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00140691-B01P
TRIM69 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM69 protein.
Información adicional
Size 50 ug
Gene Name TRIM69
Gene Alias HSD34|RNF36|Trif
Gene Description tripartite motif-containing 69
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDIKKIMPDDPERFDSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM69 (NP_542783.2, 1 a.a. ~ 341 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 140691

Enviar un mensaje


TRIM69 purified MaxPab mouse polyclonal antibody (B01P)

TRIM69 purified MaxPab mouse polyclonal antibody (B01P)