Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ACTRT2 monoclonal antibody (M03), clone 2E10
Abnova
ACTRT2 monoclonal antibody (M03), clone 2E10
Ref: AB-H00140625-M03
ACTRT2 monoclonal antibody (M03), clone 2E10
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACTRT2.
Información adicional
Size
100 ug
Gene Name
ACTRT2
Gene Alias
ARPM2|ARPT2|Arp-T2|FLJ25424|HARPM2
Gene Description
actin-related protein T2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq
DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACTRT2 (NP_536356, 209 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
140625
Clone Number
2E10
Iso type
IgG2a Lambda
Enviar un mensaje
ACTRT2 monoclonal antibody (M03), clone 2E10
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*