Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZFP28 purified MaxPab mouse polyclonal antibody (B01P)
Abnova
ZFP28 purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00140612-B01P
ZFP28 purified MaxPab mouse polyclonal antibody (B01P)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human ZFP28 protein.
Información adicional
Size
50 ug
Gene Name
ZFP28
Gene Alias
DKFZp686K03205|KIAA1431|MGC104540|mkr5
Gene Description
zinc finger protein 28 homolog (mouse)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,IF
Immunogen Prot. Seq
MRGAASASVHEPTPLPGRGAPRTKPRAGRGPTVGTPATLALPARGRPRSRNGLASKGQRGAAPTGPGHRALPSRDTALPQERNKKLEAVGTGIEPKAMSQGLVTFGDVAVDFSQEEWEWLNPIQRNLYRKVMLENYRNLASLGLCVSKPDVISSLEQGKEPWTVKRKMTRAWCPDLKAVWKIKELPLKKDFCEGKLSQAVITERLTSYNLEYSLLGEHWDYDALFETQPGLVTIKNLAVDFRQQLHPAQKNFCKN
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ZFP28 (AAH99903.1, 1 a.a. ~ 349 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
140612
Enviar un mensaje
ZFP28 purified MaxPab mouse polyclonal antibody (B01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*