ASB5 polyclonal antibody (A01)
  • ASB5 polyclonal antibody (A01)

ASB5 polyclonal antibody (A01)

Ref: AB-H00140458-A01
ASB5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ASB5.
Información adicional
Size 50 uL
Gene Name ASB5
Gene Alias -
Gene Description ankyrin repeat and SOCS box-containing 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LLYAGADVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASB5 (NP_543150, 220 a.a. ~ 328 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 140458

Enviar un mensaje


ASB5 polyclonal antibody (A01)

ASB5 polyclonal antibody (A01)