ACTRT1 purified MaxPab mouse polyclonal antibody (B01P)
  • ACTRT1 purified MaxPab mouse polyclonal antibody (B01P)

ACTRT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00139741-B01P
ACTRT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ACTRT1 protein.
Información adicional
Size 50 ug
Gene Name ACTRT1
Gene Alias AIP1|ARIP1|ARP-T1|ARPT1|HSD27|KIAA0705|MGC26590
Gene Description actin-related protein T1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKELRKSRGEVLGAYRLPDGHVIHFGDEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACTRT1 (NP_612146, 1 a.a. ~ 376 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 139741

Enviar un mensaje


ACTRT1 purified MaxPab mouse polyclonal antibody (B01P)

ACTRT1 purified MaxPab mouse polyclonal antibody (B01P)