UNC5D monoclonal antibody (M01), clone 4G3
  • UNC5D monoclonal antibody (M01), clone 4G3

UNC5D monoclonal antibody (M01), clone 4G3

Ref: AB-H00137970-M01
UNC5D monoclonal antibody (M01), clone 4G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UNC5D.
Información adicional
Size 100 ug
Gene Name UNC5D
Gene Alias FLJ16019|KIAA1777|PRO34692|Unc5h4
Gene Description unc-5 homolog D (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UNC5D (NP_543148, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 137970
Clone Number 4G3
Iso type IgG2a Kappa

Enviar un mensaje


UNC5D monoclonal antibody (M01), clone 4G3

UNC5D monoclonal antibody (M01), clone 4G3