UNC5D polyclonal antibody (A01)
  • UNC5D polyclonal antibody (A01)

UNC5D polyclonal antibody (A01)

Ref: AB-H00137970-A01
UNC5D polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UNC5D.
Información adicional
Size 50 uL
Gene Name UNC5D
Gene Alias FLJ16019|KIAA1777|PRO34692|Unc5h4
Gene Description unc-5 homolog D (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UNC5D (NP_543148, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 137970

Enviar un mensaje


UNC5D polyclonal antibody (A01)

UNC5D polyclonal antibody (A01)