ADHFE1 polyclonal antibody (A01)
  • ADHFE1 polyclonal antibody (A01)

ADHFE1 polyclonal antibody (A01)

Ref: AB-H00137872-A01
ADHFE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ADHFE1.
Información adicional
Size 50 uL
Gene Name ADHFE1
Gene Alias ADH8|FLJ32430|HMFT2263|HOT|MGC48605
Gene Description alcohol dehydrogenase, iron containing, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPRPQSEEDLAALFEASMKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ADHFE1 (NP_653251, 329 a.a. ~ 418 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 137872

Enviar un mensaje


ADHFE1 polyclonal antibody (A01)

ADHFE1 polyclonal antibody (A01)