ASZ1 monoclonal antibody (M01), clone 3C9
  • ASZ1 monoclonal antibody (M01), clone 3C9

ASZ1 monoclonal antibody (M01), clone 3C9

Ref: AB-H00136991-M01
ASZ1 monoclonal antibody (M01), clone 3C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ASZ1.
Información adicional
Size 100 ug
Gene Name ASZ1
Gene Alias ALP1|ANKL1|C7orf7|GASZ|MGC26634|Orf3
Gene Description ankyrin repeat, SAM and basic leucine zipper domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASZ1 (NP_570124, 127 a.a. ~ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 136991
Clone Number 3C9
Iso type IgG2b Kappa

Enviar un mensaje


ASZ1 monoclonal antibody (M01), clone 3C9

ASZ1 monoclonal antibody (M01), clone 3C9