ASZ1 purified MaxPab mouse polyclonal antibody (B01P)
  • ASZ1 purified MaxPab mouse polyclonal antibody (B01P)

ASZ1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00136991-B01P
ASZ1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ASZ1 protein.
Información adicional
Size 50 ug
Gene Name ASZ1
Gene Alias ALP1|ANKL1|C7orf7|GASZ|MGC26634|Orf3
Gene Description ankyrin repeat, SAM and basic leucine zipper domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTIC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASZ1 (AAH34963.1, 1 a.a. ~ 393 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 136991

Enviar un mensaje


ASZ1 purified MaxPab mouse polyclonal antibody (B01P)

ASZ1 purified MaxPab mouse polyclonal antibody (B01P)