C20orf102 monoclonal antibody (M02), clone 1A8
  • C20orf102 monoclonal antibody (M02), clone 1A8

C20orf102 monoclonal antibody (M02), clone 1A8

Ref: AB-H00128434-M02
C20orf102 monoclonal antibody (M02), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant C20orf102.
Información adicional
Size 100 ug
Gene Name VSTM2L
Gene Alias C20orf102|dJ1118M15.2
Gene Description V-set and transmembrane domain containing 2 like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C20orf102 (AAH33818.1, 25 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 128434
Clone Number 1A8
Iso type IgG1 Kappa

Enviar un mensaje


C20orf102 monoclonal antibody (M02), clone 1A8

C20orf102 monoclonal antibody (M02), clone 1A8