C20orf102 monoclonal antibody (M01), clone 3B9
  • C20orf102 monoclonal antibody (M01), clone 3B9

C20orf102 monoclonal antibody (M01), clone 3B9

Ref: AB-H00128434-M01
C20orf102 monoclonal antibody (M01), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant C20orf102.
Información adicional
Size 100 ug
Gene Name VSTM2L
Gene Alias C20orf102|dJ1118M15.2
Gene Description V-set and transmembrane domain containing 2 like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C20orf102 (AAH33818.1, 25 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 128434
Clone Number 3B9
Iso type IgG1 Kappa

Enviar un mensaje


C20orf102 monoclonal antibody (M01), clone 3B9

C20orf102 monoclonal antibody (M01), clone 3B9