APOA1BP purified MaxPab mouse polyclonal antibody (B01P)
  • APOA1BP purified MaxPab mouse polyclonal antibody (B01P)

APOA1BP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00128240-B01P
APOA1BP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human APOA1BP protein.
Información adicional
Size 50 ug
Gene Name APOA1BP
Gene Alias AIBP|MGC119143|MGC119144|MGC119145|YJEFN1
Gene Description apolipoprotein A-I binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen APOA1BP (AAI00933.1, 1 a.a. ~ 185 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 128240

Enviar un mensaje


APOA1BP purified MaxPab mouse polyclonal antibody (B01P)

APOA1BP purified MaxPab mouse polyclonal antibody (B01P)