UHMK1 monoclonal antibody (M02), clone 1H5
  • UHMK1 monoclonal antibody (M02), clone 1H5

UHMK1 monoclonal antibody (M02), clone 1H5

Ref: AB-H00127933-M02
UHMK1 monoclonal antibody (M02), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UHMK1.
Información adicional
Size 100 ug
Gene Name UHMK1
Gene Alias KIS|Kist
Gene Description U2AF homology motif (UHM) kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UHMK1 (AAH26046, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 127933
Clone Number 1H5
Iso type IgG2a Kappa

Enviar un mensaje


UHMK1 monoclonal antibody (M02), clone 1H5

UHMK1 monoclonal antibody (M02), clone 1H5