ARL8A monoclonal antibody (M02), clone 3H4
  • ARL8A monoclonal antibody (M02), clone 3H4

ARL8A monoclonal antibody (M02), clone 3H4

Ref: AB-H00127829-M02
ARL8A monoclonal antibody (M02), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ARL8A.
Información adicional
Size 100 ug
Gene Name ARL8A
Gene Alias ARL10B|FLJ45195|GIE2
Gene Description ADP-ribosylation factor-like 8A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARL8A (AAH15408, 1 a.a. ~ 186 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 127829
Clone Number 3H4
Iso type IgG2b Kappa

Enviar un mensaje


ARL8A monoclonal antibody (M02), clone 3H4

ARL8A monoclonal antibody (M02), clone 3H4