ATP6V1G3 monoclonal antibody (M13), clone 3A5
  • ATP6V1G3 monoclonal antibody (M13), clone 3A5

ATP6V1G3 monoclonal antibody (M13), clone 3A5

Ref: AB-H00127124-M13
ATP6V1G3 monoclonal antibody (M13), clone 3A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATP6V1G3.
Información adicional
Size 100 ug
Gene Name ATP6V1G3
Gene Alias ATP6G3|MGC119810|MGC119813|Vma10
Gene Description ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP6V1G3 (NP_573569, 38 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 127124
Clone Number 3A5
Iso type IgG1 Kappa

Enviar un mensaje


ATP6V1G3 monoclonal antibody (M13), clone 3A5

ATP6V1G3 monoclonal antibody (M13), clone 3A5