TRA16 polyclonal antibody (A01)
  • TRA16 polyclonal antibody (A01)

TRA16 polyclonal antibody (A01)

Ref: AB-H00126382-A01
TRA16 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRA16.
Información adicional
Size 50 uL
Gene Name NR2C2AP
Gene Alias TRA16
Gene Description nuclear receptor 2C2-associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRA16 (NP_795361, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 126382

Enviar un mensaje


TRA16 polyclonal antibody (A01)

TRA16 polyclonal antibody (A01)