CALR3 purified MaxPab rabbit polyclonal antibody (D01P)
  • CALR3 purified MaxPab rabbit polyclonal antibody (D01P)

CALR3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00125972-D01P
CALR3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CALR3 protein.
Información adicional
Size 100 ug
Gene Name CALR3
Gene Alias CRT2|FLJ25355|MGC26577
Gene Description calreticulin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALR3 (NP_659483.1, 1 a.a. ~ 384 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 125972

Enviar un mensaje


CALR3 purified MaxPab rabbit polyclonal antibody (D01P)

CALR3 purified MaxPab rabbit polyclonal antibody (D01P)