ZFP3 MaxPab mouse polyclonal antibody (B03)
  • ZFP3 MaxPab mouse polyclonal antibody (B03)

ZFP3 MaxPab mouse polyclonal antibody (B03)

Ref: AB-H00124961-B03
ZFP3 MaxPab mouse polyclonal antibody (B03)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZFP3 protein.
Información adicional
Size 50 uL
Gene Name ZFP3
Gene Alias FLJ30726|ZNF752
Gene Description zinc finger protein 3 homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQERDFPSGLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSSHLIHHHRIHTGERPYKCEECGKAFSQNSALILHQRIHTGEKPYEC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZFP3 (NP_694563.1, 1 a.a. ~ 502 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 124961

Enviar un mensaje


ZFP3 MaxPab mouse polyclonal antibody (B03)

ZFP3 MaxPab mouse polyclonal antibody (B03)