USP43 monoclonal antibody (M01), clone 1A5
  • USP43 monoclonal antibody (M01), clone 1A5

USP43 monoclonal antibody (M01), clone 1A5

Ref: AB-H00124739-M01
USP43 monoclonal antibody (M01), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP43.
Información adicional
Size 100 ug
Gene Name USP43
Gene Alias FLJ30626
Gene Description ubiquitin specific peptidase 43
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AEEGGVPADEVILVELYPSGFQRSFFDEEDLNTIAEGDNVYAFQVPPSPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP43 (NP_055881, 315 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 124739
Clone Number 1A5
Iso type IgG2a Kappa

Enviar un mensaje


USP43 monoclonal antibody (M01), clone 1A5

USP43 monoclonal antibody (M01), clone 1A5