CANT1 monoclonal antibody (M02), clone 1A1
  • CANT1 monoclonal antibody (M02), clone 1A1

CANT1 monoclonal antibody (M02), clone 1A1

Ref: AB-H00124583-M02
CANT1 monoclonal antibody (M02), clone 1A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CANT1.
Información adicional
Size 100 ug
Gene Name CANT1
Gene Alias SCAN-1|SHAPY
Gene Description calcium activated nucleotidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVKYEGIEFI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CANT1 (AAH17655, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 124583
Clone Number 1A1
Iso type IgG2a Kappa

Enviar un mensaje


CANT1 monoclonal antibody (M02), clone 1A1

CANT1 monoclonal antibody (M02), clone 1A1