CANT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CANT1 purified MaxPab rabbit polyclonal antibody (D01P)

CANT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00124583-D01P
CANT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CANT1 protein.
Información adicional
Size 100 ug
Gene Name CANT1
Gene Alias SCAN-1|SHAPY
Gene Description calcium activated nucleotidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MPVQLSEHPEWNESMHSLRISVGGLPVLASMTKAADPRFRPRWKVILTFFVGAAILWLLCSHRPAPGRPPTHNAHNWRLGQAPANWYNDTYPLSPPQRTPAGIRYRIAVIADLDTESRAQEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVKDERLYVGGLGKEWTTTTGDVVNENPEWVKVVGYKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CANT1 (NP_620148.1, 1 a.a. ~ 401 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 124583

Enviar un mensaje


CANT1 purified MaxPab rabbit polyclonal antibody (D01P)

CANT1 purified MaxPab rabbit polyclonal antibody (D01P)