TTC8 purified MaxPab rabbit polyclonal antibody (D01P)
  • TTC8 purified MaxPab rabbit polyclonal antibody (D01P)

TTC8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00123016-D01P
TTC8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TTC8 protein.
Información adicional
Size 100 ug
Gene Name TTC8
Gene Alias BBS8
Gene Description tetratricopeptide repeat domain 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC8 (NP_938051.1, 1 a.a. ~ 505 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 123016

Enviar un mensaje


TTC8 purified MaxPab rabbit polyclonal antibody (D01P)

TTC8 purified MaxPab rabbit polyclonal antibody (D01P)