ADSSL1 monoclonal antibody (M01), clone 2D12 Ver mas grande

ADSSL1 monoclonal antibody (M01), clone 2D12

AB-H00122622-M01

Producto nuevo

ADSSL1 monoclonal antibody (M01), clone 2D12

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name ADSSL1
Gene Alias FLJ38602
Gene Description adenylosuccinate synthase like 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ADSSL1 (NP_689541.1, 369 a.a. ~ 436 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 122622
Clone Number 2D12
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant ADSSL1.

Consulta sobre un producto

ADSSL1 monoclonal antibody (M01), clone 2D12

ADSSL1 monoclonal antibody (M01), clone 2D12