C14orf28 MaxPab mouse polyclonal antibody (B01P)
  • C14orf28 MaxPab mouse polyclonal antibody (B01P)

C14orf28 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00122525-B01P
C14orf28 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C14orf28 protein.
Información adicional
Size 50 ug
Gene Name C14orf28
Gene Alias DRIP1|c14_5270
Gene Description chromosome 14 open reading frame 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKTLFEEIKASIKNNYNQDRSFCRPVLPWGGVFTIKAGRKAVSCTPLYVEIRLKNTCTIDGFLMLLYVILNENENFPRELSLHFGREFVDCFLYLMDTYSFTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFTKNLENLMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCHGAPPFVVLNMQHWKSEDLAYVPYYLDLSDHKYLLEG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C14orf28 (NP_001017923.1, 1 a.a. ~ 310 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 122525

Enviar un mensaje


C14orf28 MaxPab mouse polyclonal antibody (B01P)

C14orf28 MaxPab mouse polyclonal antibody (B01P)