TTC18 purified MaxPab mouse polyclonal antibody (B01P)
  • TTC18 purified MaxPab mouse polyclonal antibody (B01P)

TTC18 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00118491-B01P
TTC18 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TTC18 protein.
Información adicional
Size 50 ug
Gene Name TTC18
Gene Alias FLJ25765|RP11-152N13.6
Gene Description tetratricopeptide repeat domain 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPSLGEKDYPILFKNGTLKLGGEREPVPRPKKWPIANILAPGANNIPDAFIVGGPYEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC18 (NP_660153, 1 a.a. ~ 1121 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 118491

Enviar un mensaje


TTC18 purified MaxPab mouse polyclonal antibody (B01P)

TTC18 purified MaxPab mouse polyclonal antibody (B01P)