UBE2J2 polyclonal antibody (A01)
  • UBE2J2 polyclonal antibody (A01)

UBE2J2 polyclonal antibody (A01)

Ref: AB-H00118424-A01
UBE2J2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE2J2.
Información adicional
Size 50 uL
Gene Name UBE2J2
Gene Alias NCUBE2|PRO2121
Gene Description ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2J2 (NP_055881, 124 a.a. ~ 224 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 118424

Enviar un mensaje


UBE2J2 polyclonal antibody (A01)

UBE2J2 polyclonal antibody (A01)