TWIST2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TWIST2 purified MaxPab rabbit polyclonal antibody (D01P)

TWIST2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00117581-D01P
TWIST2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TWIST2 protein.
Información adicional
Size 100 ug
Gene Name TWIST2
Gene Alias DERMO1|MGC117334|bHLHa39
Gene Description twist homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TWIST2 (NP_476527.1, 1 a.a. ~ 160 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 117581

Enviar un mensaje


TWIST2 purified MaxPab rabbit polyclonal antibody (D01P)

TWIST2 purified MaxPab rabbit polyclonal antibody (D01P)