C1orf19 monoclonal antibody (M01), clone 8C7
  • C1orf19 monoclonal antibody (M01), clone 8C7

C1orf19 monoclonal antibody (M01), clone 8C7

Ref: AB-H00116461-M01
C1orf19 monoclonal antibody (M01), clone 8C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C1orf19.
Información adicional
Size 100 ug
Gene Name TSEN15
Gene Alias C1orf19|sen15
Gene Description tRNA splicing endonuclease 15 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1orf19 (NP_443197, 72 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 116461
Clone Number 8C7
Iso type IgG1 Kappa

Enviar un mensaje


C1orf19 monoclonal antibody (M01), clone 8C7

C1orf19 monoclonal antibody (M01), clone 8C7