TSEN15 MaxPab rabbit polyclonal antibody (D01)
  • TSEN15 MaxPab rabbit polyclonal antibody (D01)

TSEN15 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00116461-D01
TSEN15 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TSEN15 protein.
Información adicional
Size 100 uL
Gene Name TSEN15
Gene Alias C1orf19|sen15
Gene Description tRNA splicing endonuclease 15 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSEN15 (NP_443197.1, 1 a.a. ~ 171 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 116461

Enviar un mensaje


TSEN15 MaxPab rabbit polyclonal antibody (D01)

TSEN15 MaxPab rabbit polyclonal antibody (D01)