BATF2 purified MaxPab mouse polyclonal antibody (B02P)
  • BATF2 purified MaxPab mouse polyclonal antibody (B02P)

BATF2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00116071-B02P
BATF2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BATF2 protein.
Información adicional
Size 50 ug
Gene Name BATF2
Gene Alias MGC20410
Gene Description basic leucine zipper transcription factor, ATF-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BATF2 (AAH12330, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 116071

Enviar un mensaje


BATF2 purified MaxPab mouse polyclonal antibody (B02P)

BATF2 purified MaxPab mouse polyclonal antibody (B02P)