ZNF653 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF653 purified MaxPab mouse polyclonal antibody (B01P)

ZNF653 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00115950-B01P
ZNF653 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF653 protein.
Información adicional
Size 50 ug
Gene Name ZNF653
Gene Alias E430039K05Rik|ZIP67
Gene Description zinc finger protein 653
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAERALEPEAEAEAEAGAGGEAAAEEGAAGRKARGRPRLTESDRARRRLESRKRYDVRRVYLGEAHGPWVDLRRRSGWSDAKLAAYLISLERGQRSGRHGKPWEQVPKKPKRKKRRRRNVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVGNGLVAGSSDSSSSGSASDSEESPEGQPVKAAAAAAAATPTSPVGSSGLITQEGVHIPFDVHHVESLA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF653 (NP_620138.1, 1 a.a. ~ 615 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115950

Enviar un mensaje


ZNF653 purified MaxPab mouse polyclonal antibody (B01P)

ZNF653 purified MaxPab mouse polyclonal antibody (B01P)